DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and dhs-6

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001021972.1 Gene:dhs-6 / 3565470 WormBaseID:WBGene00000970 Length:418 Species:Caenorhabditis elegans


Alignment Length:258 Identity:72/258 - (27%)
Similarity:114/258 - (44%) Gaps:29/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRN---EEKLKET----ADNIVAAGGATPLEL 61
            |..:.:::||||.|||...|:.|||.|..:|:..:.   ..||..|    |:.|..|||.. |..
 Worm     7 FVGRTVLITGASRGIGKEIALKLAKDGANIVVAAKTATAHPKLPGTIYSAAEEIEKAGGKA-LPC 70

  Fly    62 QADMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLA 126
            ..|:..||.|:..|...:.|.|.||:|:|||..:.....|.|.::::|.:.:.|.|..:.:|...
 Worm    71 IVDVRDEASVKASVEEAVKKFGGIDILINNASAISLTDTENTEMKRYDLMHSINTRGTFLMTKTC 135

  Fly   127 TPELVKTKG-NIVNVSS--VCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVI 188
            .|.|...|. :::|:|.  :...|.|...:||.::|..:.........|..|.|:.|||:.|   
 Worm   136 LPYLKSGKNPHVLNISPPLLMETRWFANHVAYTMAKYGMSMCVLGQHEEFRPHGIAVNALWP--- 197

  Fly   189 VTDIHKRGGMDEETYAKFLEHCKITHALGRPGDVKE---VAAAIAFLASDQASFTTGISLPVD 248
            :|.|          :...:|  .::...|..|..|.   ..||.|.|:.:...||....:..|
 Worm   198 LTAI----------WTAAME--MLSDKGGEAGSRKPSIMADAAYAVLSKNSKDFTGNFCIDED 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 72/258 (28%)
fabG 4..251 CDD:235975 72/258 (28%)
dhs-6NP_001021972.1 PRK08278 9..275 CDD:181349 71/256 (28%)
SCP2 319..411 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.