DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and CG31937

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:199 Identity:62/199 - (31%)
Similarity:100/199 - (50%) Gaps:10/199 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGG---ATP--LE 60
            :||.:.:|:.:||||||||.:.|:.||:.|..||:..|..|:|::..:..:||..   ||.  |.
  Fly    41 LSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLV 105

  Fly    61 LQADMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTML 125
            :|.||....|.:..:...|....|:||||||||..:..|.....:|....|...:|.::..|:.|
  Fly   106 IQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRL 170

  Fly   126 ATPELVKT---KGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGV 187
            .....|:.   :|:|...||:.|....|....|..:|.|::.:...:.:|:  :.:.|:...||.
  Fly   171 VVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEM--RKLDVSLFAPGP 233

  Fly   188 IVTD 191
            |.||
  Fly   234 IATD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 60/196 (31%)
fabG 4..251 CDD:235975 60/196 (31%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 60/196 (31%)
adh_short 47..245 CDD:278532 60/193 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
21.930

Return to query results.
Submit another query.