DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and CG10962

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster


Alignment Length:248 Identity:63/248 - (25%)
Similarity:118/248 - (47%) Gaps:32/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADM 65
            |..::::|.:::||||||||:.|..|...|..:|.:.|..::|::...::.|.......:.:.|:
  Fly     1 MDRWQNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDV 65

  Fly    66 TKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPEL 130
            ::|.:|.........:.|.||||:|||||:..|.:.....:..:.::.||:......|.||...:
  Fly    66 SQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSM 130

  Fly   131 VKTK--GNIVNVSSVCGLRAF------PGVLAYNVSKAAVDQFTACIALELAPKG--VRVNAVNP 185
            .:.:  |:::.|:|..|:..:      ..:.||..||.|:.........||..:|  ::..::||
  Fly   131 RRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINP 195

  Fly   186 GVIVTDIHKRGGMDEETYAKFLEHCKITHALGRPGDV----KEVAAAIAFLAS 234
            |.:.|:|     :.:||.||.             |:|    .:||.|:.:..|
  Fly   196 GWVATEI-----VPDETKAKL-------------GEVILQADDVAQAVLYALS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 62/245 (25%)
fabG 4..251 CDD:235975 62/245 (25%)
CG10962NP_788887.1 YdfG 1..249 CDD:226674 63/248 (25%)
NADB_Rossmann 1..243 CDD:304358 63/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.