DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and DHRS4L2

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_932349.2 Gene:DHRS4L2 / 317749 HGNCID:19731 Length:232 Species:Homo sapiens


Alignment Length:184 Identity:57/184 - (30%)
Similarity:98/184 - (53%) Gaps:9/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVA---AGGATPLELQADMTK 67
            :||.:||.::.|||.:.|..||:....:|:..|.::.:    |..||   ..|.:.......:.|
Human    32 NKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQNV----DQAVATLQGEGLSVTGTVCHVGK 92

  Fly    68 EAEVQQIVGATLAKHGRIDVLVNNAGILE-TGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELV 131
            ..:.:::|...:..||.||:||:||.:.. .||:...:.|.:|:.::.||::...:|....||:.
Human    93 AEDRERLVAMAVKLHGGIDILVSNAAVNPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEME 157

  Fly   132 KT-KGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVN 184
            |. .|::|.|||:......||...|||||.|:......:|:||||:.:|||.::
Human   158 KRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVNCLH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 57/184 (31%)
fabG 4..251 CDD:235975 57/184 (31%)
DHRS4L2NP_932349.2 NADB_Rossmann 24..>210 CDD:304358 57/181 (31%)
adh_short 33..210 CDD:278532 57/180 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140593
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.