DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and CG3699

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster


Alignment Length:256 Identity:137/256 - (53%)
Similarity:178/256 - (69%) Gaps:7/256 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLEL-QADMT 66
            |..:||:|||||||||||:.|..||:.|..|.:||||...|:.|..::    ..|..|: .||:|
  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL----KGTQAEIVVADVT 62

  Fly    67 KEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELV 131
            |:|:.  ||..||||.|||||||||||||..|.:....:|:||.::|||:|.:..||....|.|:
  Fly    63 KDADA--IVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLL 125

  Fly   132 KTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRG 196
            ||||.:|||||..|:|.|.|.|:|.|||||:||||..:|||:||:|||||:||||.:||:||:..
  Fly   126 KTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNI 190

  Fly   197 GMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGRHAMCPR 257
            |:.:|.|...|:....:|.:||.|||.|||.|:|||||.:||||||...|:|||:|.:.||
  Fly   191 GIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHNLTPR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 134/250 (54%)
fabG 4..251 CDD:235975 132/247 (53%)
CG3699NP_569875.2 fabG 1..244 CDD:235546 132/247 (53%)
NADB_Rossmann 3..248 CDD:304358 134/250 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470678
Domainoid 1 1.000 118 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111187at6656
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm42920
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43975
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
98.990

Return to query results.
Submit another query.