DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and CG13377

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:218 Identity:57/218 - (26%)
Similarity:101/218 - (46%) Gaps:34/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVA--------------- 52
            |...:|:::|.|.:.:|.....|||. .|..|..|     :||..|::.|               
  Fly    42 SHPSRVVLITSADTALGLQLCTHLAN-KGYRVFAG-----MKEAQDSLPAKLLCGWMKIREYSEE 100

  Fly    53 --AGGATPLELQADMTKE---AEVQQIVGATL-AKHGRIDVLVNNAGILETGSIEATSLEQFDRL 111
              ||...|:.|  |:|:|   .|...|:||.| |....|..::|.:|.:..|.:|:.:::|::.:
  Fly   101 PIAGTIIPMRL--DVTREDVLREATVIIGANLNADERGIAAVINTSGSVFRGQVESQNVQQWEHM 163

  Fly   112 MNTNVRSLYQLTMLATPELVKTKGNIVNVSSVCG----LRAFPGVLAYNVSKAAVDQFTACIALE 172
            :.||:....::.......|..|:|.::.:..|.|    .....|::|:|.|:.|||:....:..|
  Fly   164 LRTNILGTLRVAKAFVCFLRPTRGRLLYLGGVSGGGNARNEGDGLVAFNASRVAVDKCAEELRKE 228

  Fly   173 LAPKGVRVNAVNP-GVIVTDIHK 194
            |.|.||.|.|::. |:....::|
  Fly   229 LHPYGVSVVALDTCGMTAESLYK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 56/217 (26%)
fabG 4..251 CDD:235975 56/217 (26%)
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 55/207 (27%)
NADB_Rossmann 46..>237 CDD:304358 52/198 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435078
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.