DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and Cbr3

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001100580.1 Gene:Cbr3 / 304078 RGDID:1309728 Length:277 Species:Rattus norvegicus


Alignment Length:276 Identity:72/276 - (26%)
Similarity:112/276 - (40%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLA-KLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQAD 64
            |||. .:|.:||||:.|||.:....|. |..|.:|:..|:|.:.:.....: .|.|.:|...|.|
  Rat     1 MSSC-SRVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVKQL-QAEGLSPRFHQLD 63

  Fly    65 MTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPE 129
            :.....::.:......::|.::||||||||    :........||......:::.:..|.....|
  Rat    64 IDNPQSIRALRDFLRKEYGGLNVLVNNAGI----AFRMDDPTPFDVQAEVTLKTNFFATRNVCTE 124

  Fly   130 L---VKTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIV-- 189
            |   :|..|.:|||||:.||:|..     |.|:...::|             |.:.:..|.:|  
  Rat   125 LLPIMKPHGRVVNVSSLQGLKALE-----NCSEDLQERF-------------RCDTLTEGDLVDL 171

  Fly   190 ---------TDIHKRGGMDEETY-AKFLEHCKITHALGRPGDVKEVAAAIAF-----------LA 233
                     .::|:|.|..:..| ...|....:|..|.|..|.|..|..|..           :|
  Rat   172 MKKFVEDTKNEVHEREGWPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMA 236

  Fly   234 SDQASFTT--GISLPV 247
            .||.|.|.  |...||
  Rat   237 RDQGSRTVEEGAETPV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 69/273 (25%)
fabG 4..251 CDD:235975 69/273 (25%)
Cbr3NP_001100580.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 69/270 (26%)
adh_short 6..241 CDD:278532 64/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.