DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and Dhrs1

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001007622.1 Gene:Dhrs1 / 290234 RGDID:1359172 Length:313 Species:Rattus norvegicus


Alignment Length:208 Identity:71/208 - (34%)
Similarity:104/208 - (50%) Gaps:11/208 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTK 67
            :.|.:|.:|||||.|||...|:.|.:.|..:.|.||:.:.|:.||....:.||.. :.:..|.::
  Rat     4 TMKGQVCVVTGASRGIGRGIALQLCQAGATVYITGRHLDTLRATAQEAQSLGGRC-VPVVCDSSQ 67

  Fly    68 EAEVQQIV-GATLAKHGRIDVLVNNA-----GILE--TGSIEATSLEQFDRLMNTNVRSLYQLTM 124
            |:||:.:. .....:.||:|||||||     .||.  |.|........:|.:.|..:|..|..::
  Rat    68 ESEVKSLFEQVDREQQGRLDVLVNNAYAGVQAILNTTTKSFWEAPASLWDDINNVGLRGHYLCSV 132

  Fly   125 LATPELVKT-KGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVI 188
            .....:|.. ||.||.|||..||:....| .|.|.|||.|:..|..|.||...||...::.||::
  Rat   133 YGARLMVPAGKGLIVVVSSPGGLQHMFNV-PYGVGKAACDKLAADCAHELRRHGVSYVSLWPGLV 196

  Fly   189 VTDIHKRGGMDEE 201
            .|::.|.....||
  Rat   197 QTEMVKEYVAKEE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 71/207 (34%)
fabG 4..251 CDD:235975 71/207 (34%)
Dhrs1NP_001007622.1 PRK08303 1..271 CDD:236229 71/208 (34%)
DHRS1-like_SDR_c 5..271 CDD:187664 71/207 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.