DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and oar2

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_594074.1 Gene:oar2 / 2543512 PomBaseID:SPAC3G9.02 Length:236 Species:Schizosaccharomyces pombe


Alignment Length:251 Identity:80/251 - (31%)
Similarity:129/251 - (51%) Gaps:28/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGG----ATPLELQADMTKEA 69
            :::||.|||:|...|...::.|....||||||..||||..::..|.|    .|..::|:||....
pombe     4 VLITGGSSGLGKRIAQIWSQKGHQCHIVGRNEFHLKETLQSLSVAKGQQHTLTIADVQSDMKNLK 68

  Fly    70 EVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVKTK 134
            .:.:.|        .||.:|:.||:|::.....||.::.|.::.||:.|..:|:.:|..|..:.|
pombe    69 SIFESV--------EIDTVVHAAGVLQSSLCVRTSEKEIDSIICTNLVSAIKLSKMAILEWFRNK 125

  Fly   135 GN-----IVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHK 194
            .:     |:|:||.....|.||...|..|||.::.||..:|.|:|.||:||||::||.:.|.:  
pombe   126 NSERDRLILNISSRLSTYALPGTSVYAASKAGLESFTKVLAAEVASKGIRVNAISPGYVDTPM-- 188

  Fly   195 RGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGG 250
                 ..:..:.:...|:  .:||.....|:..|..||..::  :|||..||:.||
pombe   189 -----LSSQIRAIAEKKV--PIGRLASTDEIVDACTFLLDNR--YTTGTILPITGG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 80/251 (32%)
fabG 4..251 CDD:235975 80/251 (32%)
oar2NP_594074.1 FabG 1..236 CDD:223959 80/251 (32%)
SDR_c 4..233 CDD:212491 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 120 1.000 Domainoid score I1456
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.