DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and SPAC8E11.10

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_594161.1 Gene:SPAC8E11.10 / 2543428 PomBaseID:SPAC8E11.10 Length:255 Species:Schizosaccharomyces pombe


Alignment Length:273 Identity:88/273 - (32%)
Similarity:131/273 - (47%) Gaps:37/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLG---GLLVIVGRNEEKLKETAD-----NIVAAGGAT 57
            |.|.|.|..::||.|.|||.|.|...|..|   |||  .|||::.|:..|:     .:.|...:.
pombe     4 MFSLKGKTTLITGGSGGIGFSIAKAFAAAGSNVGLL--YGRNKKALEYAAELRDKHGVQAKAYSC 66

  Fly    58 PLELQADMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQ-----FDRLMNTNVR 117
            |:|     .:.|.::....|.....||:||::.||||    :|...|||.     :.:::..|:.
pombe    67 PIE-----NRSAVIETTNQAVEELGGRLDVMIANAGI----AIPHLSLEDKNEDIWTKVVGINLN 122

  Fly   118 SLYQLTMLATPELVKT-KGNIVNVSSVCG-LRAFPGVLA-YNVSKAAVDQFTACIALELAPKGVR 179
            ..|.....|.....|. ||:::..:|:.| :..:|...| |:.:||||......:|:|.|| ..|
pombe   123 GAYYTAQAAGHHFKKQGKGSLIFTASMSGHIANWPQQWASYHATKAAVKHLARALAVEWAP-FAR 186

  Fly   180 VNAVNPGVIVTDIHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGIS 244
            ||:|:||.|.||:....  ||....|:.|:..... :|.|   .|:..|..:||||.:|:.||..
pombe   187 VNSVSPGYIDTDLTLYA--DENLRKKWKEYTPQAR-IGLP---DELPGAYLYLASDASSYCTGSD 245

  Fly   245 LPVDGGRHAMCPR 257
            :.||||   .|.|
pombe   246 IIVDGG---YCSR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 84/265 (32%)
fabG 4..251 CDD:235975 83/262 (32%)
SPAC8E11.10NP_594161.1 PRK05867 1..252 CDD:135631 86/268 (32%)
MDH-like_SDR_c 2..254 CDD:187610 86/270 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.