DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and SPAC22A12.17c

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_593247.1 Gene:SPAC22A12.17c / 2541844 PomBaseID:SPAC22A12.17c Length:261 Species:Schizosaccharomyces pombe


Alignment Length:261 Identity:81/261 - (31%)
Similarity:117/261 - (44%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTK 67
            |.|.|..:|.|.:.|||.:.....|:.|....|| .|....::.|..|..|.|......:.|:|.
pombe    18 SLKGKNAVVFGGARGIGHAICSVFAEAGANAFIV-YNTTPGEKAAKEIAQANGVKTYTCKCDVTI 81

  Fly    68 EAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVK 132
            ..||:............||::|.|.||....|....:.|:|...:|.|:..::.:...|.|...|
pombe    82 PKEVEHAFAEIQKVFDTIDIVVPNNGICTGKSAIDMTYEEFANEINVNLLGVFNVAHNAGPIFQK 146

  Fly   133 T-KGNIVNVSSVCGLRAFPGVL-------AYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIV 189
            . .|::|..:|:.|:     |:       |||.|||.|.|....:|:|.. |..|||.|:||...
pombe   147 QGHGSLVATASMSGV-----VVNVPQQQCAYNTSKAGVIQLIKSLAVEWR-KFARVNCVSPGYTT 205

  Fly   190 TDI-----HKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDG 249
            :|:     ||    :.|.|..|          .|.|..||:|:|..:||||.||:.:|.:|.|||
pombe   206 SDMTGGKFHK----EWEPYTPF----------ERNGLAKEIASAYLYLASDAASYASGTNLIVDG 256

  Fly   250 G 250
            |
pombe   257 G 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 80/260 (31%)
fabG 4..251 CDD:235975 80/260 (31%)
SPAC22A12.17cNP_593247.1 MDH-like_SDR_c 14..260 CDD:187610 81/261 (31%)
fabG 18..257 CDD:235500 79/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.