DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and Cbr4

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_663570.2 Gene:Cbr4 / 234309 MGIID:2384567 Length:236 Species:Mus musculus


Alignment Length:246 Identity:89/246 - (36%)
Similarity:124/246 - (50%) Gaps:17/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAE 70
            |||..|.|.|.|||.:.|..:|:.|..|.||.||.|..|.||..:    |...|..:.|:.||.:
Mouse     2 DKVCAVFGGSRGIGRAVAQLMAQKGYRLAIVSRNLEVAKVTAGEL----GGNHLAFRCDVAKEQD 62

  Fly    71 VQQIVGATLAKH-GRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVKTK 134
            ||... ..:.|| |.::.|||.|||.....:..|..|.....::||:.........|...:::..
Mouse    63 VQSTF-QEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMISQLHTNLLGSMLTCKAAMKTMIQQG 126

  Fly   135 GNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGGMD 199
            |:||||.|:.||:...|..||:.:|..:..|:..:|.|:|.|.:|||.|.||.|.||:.:.  :.
Mouse   127 GSIVNVGSIIGLKGNVGQSAYSATKGGLVGFSRSLAKEVARKKIRVNVVAPGFIRTDMTRH--LK 189

  Fly   200 EETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGG 250
            |       ||.|....|||.|:..|||.|:.||.  ::.:.||..|.||||
Mouse   190 E-------EHFKKNIPLGRFGETLEVAHAVVFLL--ESPYITGHVLIVDGG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 89/246 (36%)
fabG 4..251 CDD:235975 89/246 (36%)
Cbr4NP_663570.2 fabG 1..234 CDD:235546 89/246 (36%)
NADB_Rossmann 3..232 CDD:304358 88/245 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.