DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and decr-1.2

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_495805.1 Gene:decr-1.2 / 189090 WormBaseID:WBGene00012177 Length:309 Species:Caenorhabditis elegans


Alignment Length:255 Identity:78/255 - (30%)
Similarity:125/255 - (49%) Gaps:10/255 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTK 67
            :||.|:::|||..:|||.:.|...|.|...:||..|..|||::||.:|....|.|....|.|:..
 Worm    22 AFKGKLVLVTGGGTGIGKAIATTFAHLRATVVIAARRMEKLEQTARDITKITGGTCEPFQMDIKD 86

  Fly    68 EAEVQQIVGATLAKHGRI-DVLVNNAG---ILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATP 128
            ...|.........|.|:: ::|||||.   |:.|   |..|...:..:::..::..:.:|.....
 Worm    87 PGMVSDAFDKIDMKFGKVPEILVNNAAGNFIMAT---ELLSSNAYGTIIDIVLKGTFNVTTELGK 148

  Fly   129 ELV--KTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTD 191
            ..:  ||..:|.::::.......|.::...||||.|:..|..:|.|.:..|:|.|||:||.|.|.
 Worm   149 RCIQNKTGASITSITAGYARAGAPFIVPSAVSKAGVETMTKSLATEWSKYGLRFNAVSPGPIPTK 213

  Fly   192 IHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGR 251
             ...|.::........|..|..:..||.|..:|||..:||::||..||..|..:.:|||:
 Worm   214 -GAWGRLNSGEMGDIAEKMKFLNPEGRVGSPEEVANLVAFISSDHMSFLNGAIIDLDGGQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 78/254 (31%)
fabG 4..251 CDD:235975 77/252 (31%)
decr-1.2NP_495805.1 TER_DECR_SDR_a 23..274 CDD:187627 78/254 (31%)
PRK07677 25..272 CDD:181077 75/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.