DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and stdh-4

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001355440.1 Gene:stdh-4 / 184934 WormBaseID:WBGene00006435 Length:317 Species:Caenorhabditis elegans


Alignment Length:205 Identity:48/205 - (23%)
Similarity:89/205 - (43%) Gaps:34/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAEVQQI 74
            :||||:.|||.|.|:.||:.|..:.::.|.:.||.:|...|        |...:|:.....:...
 Worm    57 VVTGATDGIGRSYALDLARRGFNIFLISRTKSKLVKTKKQI--------LNKYSDIEVRYAICDF 113

  Fly    75 VGATLAKHGR---------IDVLVNNAGI----------LETGSIEATSLEQFDRLMNTNVRSLY 120
            ...:...:.|         |.:|:||.|:          :|.|      ::....::|.|:..:.
 Worm   114 TRVSYEDYKRLLHSLNEVDIGILINNVGMCFDNPEVLHRVEGG------IDTLTNVINVNILPVT 172

  Fly   121 QLTMLATPELVKTK-GNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVN 184
            .||....|:::..| |.|||:.|..|.........|:.:|..::.||:.:..|...:|:....:.
 Worm   173 LLTAGILPQMMARKSGIIVNIGSAAGSIHMAKWSVYSATKKYIEWFTSILQKEYENEGIICQTIT 237

  Fly   185 PGVIVTDIHK 194
            |.::.|::.|
 Worm   238 PLLVSTNMIK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 48/205 (23%)
fabG 4..251 CDD:235975 48/205 (23%)
stdh-4NP_001355440.1 17beta-HSD1_like_SDR_c 53..295 CDD:187614 48/205 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.