Sequence 1: | NP_001262292.1 | Gene: | CG31549 / 40689 | FlyBaseID: | FBgn0051549 | Length: | 257 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001355440.1 | Gene: | stdh-4 / 184934 | WormBaseID: | WBGene00006435 | Length: | 317 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 48/205 - (23%) |
---|---|---|---|
Similarity: | 89/205 - (43%) | Gaps: | 34/205 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 IVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAEVQQI 74
Fly 75 VGATLAKHGR---------IDVLVNNAGI----------LETGSIEATSLEQFDRLMNTNVRSLY 120
Fly 121 QLTMLATPELVKTK-GNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVN 184
Fly 185 PGVIVTDIHK 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31549 | NP_001262292.1 | NADB_Rossmann | 4..254 | CDD:304358 | 48/205 (23%) |
fabG | 4..251 | CDD:235975 | 48/205 (23%) | ||
stdh-4 | NP_001355440.1 | 17beta-HSD1_like_SDR_c | 53..295 | CDD:187614 | 48/205 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D913128at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |