DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and dhs-25

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_508282.2 Gene:dhs-25 / 180486 WormBaseID:WBGene00000988 Length:248 Species:Caenorhabditis elegans


Alignment Length:251 Identity:80/251 - (31%)
Similarity:125/251 - (49%) Gaps:20/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAEV 71
            ::.:|||.:||||.:.:..|||.|..:|:...:......||..:.|:...:  ....|::....|
 Worm     8 RIAVVTGGASGIGKAISQTLAKHGARVVVADLDSGNAAATAKALPASQSHS--SFACDVSNADSV 70

  Fly    72 QQIVGATLAKH----GRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVK 132
            :     .|::|    |...:|||.|||.:..::.....||:|.::..|:..::.::.......|.
 Worm    71 K-----GLSEHVKSLGTPSILVNCAGITKDSTLLKMKQEQWDSVIKVNLTGVFHVSQAFVKASVD 130

  Fly   133 TKG---NIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHK 194
            ...   :|:||||:.|.....|...|..:||.|..||...|.|||.|.||||||.||.|.|.:.:
 Worm   131 NNNHPLSIINVSSIVGKMGNFGQTNYAATKAGVIGFTKSAAKELAKKNVRVNAVLPGFIKTPMTE 195

  Fly   195 RGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGG 250
              .|.....|   |.|| ...:||.|:.:|:|.::.:||||.:|:.||.:|.|.||
 Worm   196 --AMPPTVLA---EICK-GIPMGRMGEAEEIANSVLYLASDLSSYVTGATLEVTGG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 80/251 (32%)
fabG 4..251 CDD:235975 80/251 (32%)
dhs-25NP_508282.2 fabG 4..248 CDD:235546 80/251 (32%)
BKR_SDR_c 8..245 CDD:187594 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.