DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and dhs-13

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_503501.1 Gene:dhs-13 / 178658 WormBaseID:WBGene00000976 Length:257 Species:Caenorhabditis elegans


Alignment Length:255 Identity:87/255 - (34%)
Similarity:139/255 - (54%) Gaps:17/255 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETA-----DNIVAAGGATPLELQADM 65
            |:|.:||.::.|||.:.|..|...|..:|:..|.:|.:.|..     :||.|.|....:..::|.
 Worm    11 DRVALVTASTKGIGFAIAKQLGAAGASVVVCSRKKENVDEAVAALRLENIDAHGTTAHVGNKSDR 75

  Fly    66 TKEAEVQQIVGATLAKHGRIDVLVNNAGI-LETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPE 129
            ||      ::..||.:..::|:||:||.: ...|.:...:..|:|:|::.||:|.::||..|.|.
 Worm    76 TK------LIDFTLDRFTKLDILVSNAAVNPHYGDLMKVTDSQWDKLLDLNVKSAFELTKEAVPH 134

  Fly   130 L-VKTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIH 193
            | ...:||:|.||||.|......:.||:|.|..:...:..:||.||.:.:|||::.||:|.||..
 Worm   135 LEASGRGNVVFVSSVAGYSPMNEIGAYSVMKTTLTGLSKSLALNLARRNIRVNSIAPGIIQTDFS 199

  Fly   194 KRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGRHA 253
            :....||....|:|...    |..|.||..|.|.|:|||.||:||:.:|.::.::||.||
 Worm   200 QVLFSDESEKQKWLSQI----AQRRFGDPDECAEAVAFLVSDEASYISGETIGINGGMHA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 87/255 (34%)
fabG 4..251 CDD:235975 84/251 (33%)
dhs-13NP_503501.1 NADB_Rossmann 9..257 CDD:304358 87/255 (34%)
fabG 9..253 CDD:235975 84/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.