DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and dhs-9

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_498146.1 Gene:dhs-9 / 175737 WormBaseID:WBGene00000973 Length:319 Species:Caenorhabditis elegans


Alignment Length:260 Identity:81/260 - (31%)
Similarity:117/260 - (45%) Gaps:39/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEK----------LKETADNIVAAGGAT 57
            |...::.||||||.|||...|:.|.:.|..:.|.||..|:          |:.|||.|...|| .
 Worm     2 SLAGQIAIVTGASRGIGRGIALQLGEAGATVYITGRKPEESLNSKVGLSGLEATADEITKRGG-K 65

  Fly    58 PLELQADMTKEAEVQQIVGATLAKH-GRIDVLVNNA--GILETGSIEATSLEQ------------ 107
            .:....|.....||:........:| |::|:|||||  |:        |::.:            
 Worm    66 GIARFVDHQNMEEVKNFFEVVEKEHQGQLDILVNNAYQGV--------TAISENMGKPFYETDPY 122

  Fly   108 -FDRLMNTNVRSLYQLTMLATPEL-VKTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIA 170
             :|.:.|..:|:.|..|:.|...: .:.||.||||||..|||....| ||.|.|.|:|:.:|..|
 Worm   123 VWDTINNVGLRNHYFCTVYAARLMTARNKGLIVNVSSGGGLRYLFNV-AYGVGKQALDRMSADTA 186

  Fly   171 LELAPKGVRVNAVNPGVIVTDIHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASD 235
            :||..|.|.|.::.||.:.|::..:...||.  .|.....|..........|:....|:..||||
 Worm   187 VELRKKNVCVVSIWPGAVRTELVDKMFKDEN--GKPRPEIKNAEVFANGETVEYPGRAVVSLASD 249

  Fly   236  235
             Worm   250  249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 80/259 (31%)
fabG 4..251 CDD:235975 80/259 (31%)
dhs-9NP_498146.1 PRK08303 1..279 CDD:236229 81/260 (31%)
NADB_Rossmann 3..276 CDD:304358 80/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.