DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and DECR1

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001350.1 Gene:DECR1 / 1666 HGNCID:2753 Length:335 Species:Homo sapiens


Alignment Length:260 Identity:68/260 - (26%)
Similarity:114/260 - (43%) Gaps:15/260 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMT 66
            :||:.||..:||..:|:|......|:.||...||..|..:.||.||:.|.:..|.....:|.|:.
Human    55 NSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVR 119

  Fly    67 KEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELV 131
            ....||..|...:...|..::::|||........|..|...:..:.:..:.....:|:....:|:
Human   120 DPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLI 184

  Fly   132 KT-KG-NIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTD--- 191
            |. || ..::::::........|:....:||.|:..:..:|.|....|:|.|.:.||.|.|.   
Human   185 KAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAF 249

  Fly   192 --IHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGRHAM 254
              :...|..::|...:.        ..||.|.|:|:|...|||.||.||:..|..:..|||...:
Human   250 SRLDPTGTFEKEMIGRI--------PCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVL 306

  Fly   255  254
            Human   307  306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 67/256 (26%)
fabG 4..251 CDD:235975 66/253 (26%)
DECR1NP_001350.1 TER_DECR_SDR_a 57..303 CDD:187627 66/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.