DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and Cbr2

DIOPT Version :10

Sequence 1:NP_730972.2 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_031647.1 Gene:Cbr2 / 12409 MGIID:107200 Length:244 Species:Mus musculus


Alignment Length:143 Identity:28/143 - (19%)
Similarity:46/143 - (32%) Gaps:48/143 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 PEMRVHETKIQPFLPSPSPSNDATTTTSDPSVSSEISMEQPIQPIVSNLKLRLSEGLSETVSPAA 366
            ||...| |.:.|..|..:.::.......:....|.::.:||.....       .|.:.:..|..|
Mouse    68 PEADTH-THLTPDQPPDTHTHLTPDQHPEADTHSHLTPDQPPDDCA-------GEEMRQKHSGCA 124

  Fly   367 SPIVKTKSRKEKKTNQQMLKGSASSPNMNSQNLIINRKTTEADVENDKPKPNTNRTFEVVTVSVV 431
            ||...::||. |:|                             ||..|..|..:|..|.|     
Mouse   125 SPAGNSESRL-KRT-----------------------------VEKRKTSPYFSRRSEAV----- 154

  Fly   432 NVDFARKPKKSVY 444
                 |:|::.|:
Mouse   155 -----RRPRRKVF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_730972.2 Rossmann-fold NAD(P)(+)-binding proteins 4..254 CDD:473865
Cbr2NP_031647.1 XR_like_SDR_c 1..244 CDD:187609 28/143 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.