DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and DHRS2

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_878912.1 Gene:DHRS2 / 10202 HGNCID:18349 Length:300 Species:Homo sapiens


Alignment Length:195 Identity:66/195 - (33%)
Similarity:104/195 - (53%) Gaps:12/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKL-----KETADNIVAAGGATPLELQADM 65
            ::|.:|||::||||.:.|..||:.|..:||..|.::.:     |...:.:..||      :...:
Human    36 NRVAVVTGSTSGIGFAIARRLARDGAHVVISSRKQQNVDRAMAKLQGEGLSVAG------IVCHV 94

  Fly    66 TKEAEVQQIVGATLAKHGRIDVLVNNAGILE-TGSIEATSLEQFDRLMNTNVRSLYQLTMLATPE 129
            .|..:.:|:|...|...|.:|.||.:||:.. .||...||.:.:|::::.||:|...|.....|.
Human    95 GKAEDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLLPY 159

  Fly   130 LVKTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHK 194
            :...:|.::.|||:........:..|||||.|:...|..:|||||||.:|||.|.||:|.||..|
Human   160 MENRRGAVILVSSIAAYNPVVALGVYNVSKTALLGLTRTLALELAPKDIRVNCVVPGIIKTDFSK 224

  Fly   195  194
            Human   225  224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 66/195 (34%)
fabG 4..251 CDD:235975 66/195 (34%)
DHRS2NP_878912.1 SDR 27..>226 CDD:330230 66/195 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140596
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.