Sequence 1: | NP_001262292.1 | Gene: | CG31549 / 40689 | FlyBaseID: | FBgn0051549 | Length: | 257 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_878912.1 | Gene: | DHRS2 / 10202 | HGNCID: | 18349 | Length: | 300 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 66/195 - (33%) |
---|---|---|---|
Similarity: | 104/195 - (53%) | Gaps: | 12/195 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 DKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKL-----KETADNIVAAGGATPLELQADM 65
Fly 66 TKEAEVQQIVGATLAKHGRIDVLVNNAGILE-TGSIEATSLEQFDRLMNTNVRSLYQLTMLATPE 129
Fly 130 LVKTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHK 194
Fly 195 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31549 | NP_001262292.1 | NADB_Rossmann | 4..254 | CDD:304358 | 66/195 (34%) |
fabG | 4..251 | CDD:235975 | 66/195 (34%) | ||
DHRS2 | NP_878912.1 | SDR | 27..>226 | CDD:330230 | 66/195 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140596 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0725 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000019 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.830 |