DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and hsd17b14

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_002935043.1 Gene:hsd17b14 / 100498205 XenbaseID:XB-GENE-986127 Length:276 Species:Xenopus tropicalis


Alignment Length:261 Identity:81/261 - (31%)
Similarity:136/261 - (52%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKE 68
            ::|:|.::||.:.|||.:......|.|..:|...::.| .|...:.|.|||....:.:..|:|||
 Frog    12 YRDRVAVITGGTKGIGEAMVKEFVKSGARVVFCSKDTE-AKALENEIKAAGPGDCIYVCCDVTKE 75

  Fly    69 AEVQQIVGATLAKHGRIDVLVNNAG-ILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVK 132
            .::::::..|:..:|:||.|:|||| .....:|:.||.:.|..|:|.|:...:.....|.|.|.|
 Frog    76 EDIKKLIEITVMNYGQIDCLINNAGWHPPEQTIDGTSADDFRDLLNLNLIGYFLTAKYALPHLRK 140

  Fly   133 TKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDI----- 192
            |:|||:|:||:.|:......:.|..:|.||...|..:|::.:...||:|:::||.|.|.:     
 Frog   141 TQGNIINISSLVGIIGQKHAIPYVATKGAVTAMTKAMAVDESRHNVRINSISPGNIWTPLWEELS 205

  Fly   193 -HKR-------GGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDG 249
             |.:       ||:|.:             .|||.|..:|.|.|..:||: :.:|.|||.|.:.|
 Frog   206 SHSKNSEAMIQGGIDAQ-------------LLGRMGTAEECAKAALYLAA-EGTFCTGIDLLLTG 256

  Fly   250 G 250
            |
 Frog   257 G 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 81/261 (31%)
fabG 4..251 CDD:235975 81/261 (31%)
hsd17b14XP_002935043.1 NADB_Rossmann 6..265 CDD:389744 81/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.