DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and hsdl1

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_002937365.1 Gene:hsdl1 / 100489686 XenbaseID:XB-GENE-989915 Length:322 Species:Xenopus tropicalis


Alignment Length:209 Identity:61/209 - (29%)
Similarity:102/209 - (48%) Gaps:15/209 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAEVQQI 74
            :||||:|||..:.|..||:.|..:|:|..|.|||::.:|:|.|..|.....::.|..|..|..:.
 Frog    71 VVTGATSGIAQAYAEELARCGMNVVLVDNNREKLQKMSDSITATHGVNTSFIEVDFCKGHEAYRP 135

  Fly    75 VGATLAKHGRIDVLVNNAG-ILE-TGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELV-KTKGN 136
            :...| :|..:.:|||..| .|| ..|:.....||..::::.:|.:...:..:..|.:. :.:|.
 Frog   136 IKDAL-RHVEVGILVNCVGNFLEYPQSVIECPEEQLWKIIHVSVSAATIMAKIVVPGMAQRRRGA 199

  Fly   137 IVNVS-SVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTD--IHKRGGM 198
            ||||| ..|....|| :..|...:..:|.||..:..||:.||:.|.::.|..:..:  :|.|...
 Frog   200 IVNVSFRSCCKPNFP-MTMYTPCQLYMDGFTKELQSELSSKGIFVQSLTPLCVAKERTLHYRPSF 263

  Fly   199 -------DEETYAK 205
                   ..|.||:
 Frog   264 RFPFLVPSPEVYAR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 61/209 (29%)
fabG 4..251 CDD:235975 61/209 (29%)
hsdl1XP_002937365.1 17beta-HSD1_like_SDR_c 67..309 CDD:187614 61/209 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.