DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13A and MRPL23

DIOPT Version :9

Sequence 1:NP_649560.1 Gene:RpL13A / 40687 FlyBaseID:FBgn0037351 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_014793.1 Gene:MRPL23 / 854321 SGDID:S000005676 Length:163 Species:Saccharomyces cerevisiae


Alignment Length:113 Identity:36/113 - (31%)
Similarity:50/113 - (44%) Gaps:20/113 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGRLASVVAKYLLQ------------GGKVAVVRCEELNLSGHFYRNKIKFLAYLR----KRCNV 66
            ||||||.:|..|:.            |..|.|..|:::.::|..:..|..:....|    |...:
Yeast    28 LGRLASAIAITLIGRHKPVYHPSQDCGDYVVVTNCQKIRVTGKKFEQKTYWSHSGRPGQLKLQTM 92

  Fly    67 NPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPY 114
            |.......|   ..|..|||.||:| |.|..:..|.||:||||..:||
Yeast    93 NKVVADKGF---GEILKKAVSGMLP-KNKLRKQRLDRLKVFDGSENPY 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13ANP_649560.1 Ribosomal_L13 6..203 CDD:412316 36/113 (32%)
MRPL23NP_014793.1 rplM_bact 4..147 CDD:162186 36/113 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.