DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13A and AT3G24830

DIOPT Version :9

Sequence 1:NP_649560.1 Gene:RpL13A / 40687 FlyBaseID:FBgn0037351 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_189127.1 Gene:AT3G24830 / 822081 AraportID:AT3G24830 Length:206 Species:Arabidopsis thaliana


Alignment Length:188 Identity:104/188 - (55%)
Similarity:141/188 - (75%) Gaps:1/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TGLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLRKRCNV 66
            :|:.::.||:|.|.|:.|||||::||.||.|..|.||||||:.|||...|.|:|::.:||||.|.
plant     5 SGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNT 69

  Fly    67 NPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVVVPIAMRVLTL 131
            .|:.||.||||||:||::.||||||||||||.||||||:||:|:|.||||.:|:|:|.|::||.|
plant    70 KPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKVKRMVIPDALKVLRL 134

  Fly   132 RSDRKYCQVGRLSHEVGWHYQDVIKSLERKRKAKLRVTLKHNRELKKLTVKARENIAK 189
            ::..|||.:||||.||||::.|.||.||.|||.:.:...:..::|.||..|| |.:|:
plant   135 QAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQALYERKKQLTKLRAKA-EKVAE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13ANP_649560.1 Ribosomal_L13 6..203 CDD:412316 103/184 (56%)
AT3G24830NP_189127.1 PTZ00068 9..194 CDD:240253 103/184 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 153 1.000 Domainoid score I1367
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I1173
OMA 1 1.010 - - QHG53755
OrthoDB 1 1.010 - - D1312756at2759
OrthoFinder 1 1.000 - - FOG0001720
OrthoInspector 1 1.000 - - otm2695
orthoMCL 1 0.900 - - OOG6_100793
Panther 1 1.100 - - LDO PTHR11545
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1276
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.