DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13A and AT3G07110

DIOPT Version :9

Sequence 1:NP_649560.1 Gene:RpL13A / 40687 FlyBaseID:FBgn0037351 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001030654.1 Gene:AT3G07110 / 819897 AraportID:AT3G07110 Length:207 Species:Arabidopsis thaliana


Alignment Length:189 Identity:106/189 - (56%)
Similarity:141/189 - (74%) Gaps:2/189 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TGLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLRKRCNV 66
            :|:..:.||:|.|.|:||||||||||.||.|..:.||||||:.|||...|.|:|::.:||||.|.
plant     5 SGICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYMRFLRKRMNT 69

  Fly    67 NPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVVVPIAMRVLTL 131
            .|:.||.||||||:||::.||||||||||||..|||||:||:|:|:||||.:|:|||.|::||.|
plant    70 KPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKIKRMVVPDALKVLRL 134

  Fly   132 RSDRKYCQVGRLSHEVGWHYQDVIK-SLERKRKAKLRVTLKHNRELKKLTVKARENIAK 189
            ::..|||.:||||.||||::.|.|| .||.|||.:.:...:..::|.||..|| |.:|:
plant   135 QAGHKYCLLGRLSSEVGWNHYDTIKQELENKRKERAQAVYERKKQLSKLRAKA-EKVAE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13ANP_649560.1 Ribosomal_L13 6..203 CDD:412316 105/185 (57%)
AT3G07110NP_001030654.1 PTZ00068 10..195 CDD:240253 105/184 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 153 1.000 Domainoid score I1367
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I1173
OMA 1 1.010 - - QHG53755
OrthoDB 1 1.010 - - D1312756at2759
OrthoFinder 1 1.000 - - FOG0001720
OrthoInspector 1 1.000 - - otm2695
orthoMCL 1 0.900 - - OOG6_100793
Panther 1 1.100 - - O PTHR11545
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.