DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13A and Mrpl13

DIOPT Version :10

Sequence 1:NP_649560.1 Gene:RpL13A / 40687 FlyBaseID:FBgn0037351 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_081035.1 Gene:Mrpl13 / 68537 MGIID:2137218 Length:178 Species:Mus musculus


Alignment Length:136 Identity:34/136 - (25%)
Similarity:55/136 - (40%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VIDGRGHLLGRLASVVAKYLLQ-------------GGKVAVVRCEELNLSGHFYRNKI--KFLAY 59
            ::||:....|:|| |:|...||             |..|.::....:..||:.:..|:  ....|
Mouse    20 LLDGKMQPPGKLA-VIASNKLQGLNKPVYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGY 83

  Fly    60 LRKRCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVV--V 122
            ......|..|:  .|.:.|..|...|:.||:|....| :..:.||.:|.....|.|..:.:|  :
Mouse    84 PGGFRQVTAAQ--LHRKDPVAIVKLAIYGMLPKNLHR-RTMMQRLHLFPDEDIPEDILKNLVEEL 145

  Fly   123 PIAMRV 128
            |...||
Mouse   146 PQPRRV 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13ANP_649560.1 Ribosomal_L13 6..203 CDD:469724 34/136 (25%)
Mrpl13NP_081035.1 Ribosomal_L13 16..134 CDD:459856 28/117 (24%)

Return to query results.
Submit another query.