DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13A and Mrpl13

DIOPT Version :9

Sequence 1:NP_649560.1 Gene:RpL13A / 40687 FlyBaseID:FBgn0037351 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_081035.1 Gene:Mrpl13 / 68537 MGIID:2137218 Length:178 Species:Mus musculus


Alignment Length:136 Identity:34/136 - (25%)
Similarity:55/136 - (40%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VIDGRGHLLGRLASVVAKYLLQ-------------GGKVAVVRCEELNLSGHFYRNKI--KFLAY 59
            ::||:....|:|| |:|...||             |..|.::....:..||:.:..|:  ....|
Mouse    20 LLDGKMQPPGKLA-VIASNKLQGLNKPVYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGY 83

  Fly    60 LRKRCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVV--V 122
            ......|..|:  .|.:.|..|...|:.||:|....| :..:.||.:|.....|.|..:.:|  :
Mouse    84 PGGFRQVTAAQ--LHRKDPVAIVKLAIYGMLPKNLHR-RTMMQRLHLFPDEDIPEDILKNLVEEL 145

  Fly   123 PIAMRV 128
            |...||
Mouse   146 PQPRRV 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13ANP_649560.1 Ribosomal_L13 6..203 CDD:412316 34/136 (25%)
Mrpl13NP_081035.1 Ribosomal_L13 17..140 CDD:278969 30/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.