DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13A and mrpl13

DIOPT Version :9

Sequence 1:NP_649560.1 Gene:RpL13A / 40687 FlyBaseID:FBgn0037351 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001018370.1 Gene:mrpl13 / 553555 ZFINID:ZDB-GENE-050522-167 Length:179 Species:Danio rerio


Alignment Length:139 Identity:30/139 - (21%)
Similarity:53/139 - (38%) Gaps:31/139 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VIDGRGHLLGRLASVVAKYLLQ------------GGKVAVVRCEELNLSGHFYRNKI--KFLAYL 60
            :||.|....|::||:.|..|..            |..|.|:..:.:..||:.:..|:  ....:.
Zfish    20 LIDARMQPPGKIASMCAVRLQGKHKPIYHPLSDIGDHVVVMNTKHIAFSGNKWEQKVYSSHTGHP 84

  Fly    61 RKRCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVF--------------DGIP 111
            .....|..|:  .|.:..:.|...||.||:|....| :..:.||.:|              :.:|
Zfish    85 GSFKQVTAAQ--LHRKDSTAIIKLAVYGMLPRNLTR-RTMMQRLHLFPDDVLPEDILKNLTEELP 146

  Fly   112 SPYDKRRRV 120
            .|.:..|::
Zfish   147 QPREIPRKL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13ANP_649560.1 Ribosomal_L13 6..203 CDD:412316 30/139 (22%)
mrpl13NP_001018370.1 Ribosomal_L13 18..140 CDD:278969 27/122 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.