DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13A and mrpl13

DIOPT Version :10

Sequence 1:NP_649560.1 Gene:RpL13A / 40687 FlyBaseID:FBgn0037351 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001018370.1 Gene:mrpl13 / 553555 ZFINID:ZDB-GENE-050522-167 Length:179 Species:Danio rerio


Alignment Length:139 Identity:30/139 - (21%)
Similarity:53/139 - (38%) Gaps:31/139 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VIDGRGHLLGRLASVVAKYLLQ------------GGKVAVVRCEELNLSGHFYRNKI--KFLAYL 60
            :||.|....|::||:.|..|..            |..|.|:..:.:..||:.:..|:  ....:.
Zfish    20 LIDARMQPPGKIASMCAVRLQGKHKPIYHPLSDIGDHVVVMNTKHIAFSGNKWEQKVYSSHTGHP 84

  Fly    61 RKRCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVF--------------DGIP 111
            .....|..|:  .|.:..:.|...||.||:|....| :..:.||.:|              :.:|
Zfish    85 GSFKQVTAAQ--LHRKDSTAIIKLAVYGMLPRNLTR-RTMMQRLHLFPDDVLPEDILKNLTEELP 146

  Fly   112 SPYDKRRRV 120
            .|.:..|::
Zfish   147 QPREIPRKL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13ANP_649560.1 Ribosomal_L13 6..203 CDD:469724 30/139 (22%)
mrpl13NP_001018370.1 Ribosomal_L13 18..131 CDD:238230 27/113 (24%)

Return to query results.
Submit another query.