DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13A and rpl13a

DIOPT Version :9

Sequence 1:NP_649560.1 Gene:RpL13A / 40687 FlyBaseID:FBgn0037351 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001016486.1 Gene:rpl13a / 549240 XenbaseID:XB-GENE-5862263 Length:231 Species:Xenopus tropicalis


Alignment Length:196 Identity:114/196 - (58%)
Similarity:153/196 - (78%) Gaps:0/196 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLRKRCNVNPARG 71
            :.::||||||||||||::|||.:|.|.||.|||||.:|:||:|||||:|:||:||||.|.||:||
 Frog    33 QVLIIDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRG 97

  Fly    72 PFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRK 136
            |:|||||||||::.||||:|||||||||||.||:||||||.|||||:|:|||.|::::.|:..||
 Frog    98 PYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKIVRLKPTRK 162

  Fly   137 YCQVGRLSHEVGWHYQDVIKSLERKRKAKLRVTLKHNRELKKLTVKARENIAKAAEPFNKIIKSY 201
            :..:|||:|||||.||.|..:||.|||.|.::.....:.:.||..:|.:|:......:..::|.|
 Frog   163 FAFLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYNKKKIIVKLRKQAEKNVESKISKYTDVLKQY 227

  Fly   202 G 202
            |
 Frog   228 G 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13ANP_649560.1 Ribosomal_L13 6..203 CDD:412316 114/196 (58%)
rpl13aNP_001016486.1 PTZ00068 34..228 CDD:240253 112/193 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4438
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H111053
Inparanoid 1 1.050 250 1.000 Inparanoid score I3157
OMA 1 1.010 - - QHG53755
OrthoDB 1 1.010 - - D1312756at2759
OrthoFinder 1 1.000 - - FOG0001720
OrthoInspector 1 1.000 - - oto102758
Panther 1 1.100 - - LDO PTHR11545
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1111
SonicParanoid 1 1.000 - - X1276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.