DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13A and RPL13A

DIOPT Version :9

Sequence 1:NP_649560.1 Gene:RpL13A / 40687 FlyBaseID:FBgn0037351 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_036555.1 Gene:RPL13A / 23521 HGNCID:10304 Length:203 Species:Homo sapiens


Alignment Length:196 Identity:114/196 - (58%)
Similarity:159/196 - (81%) Gaps:0/196 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLRKRCNVNPARG 71
            :.:|:|||||||||||::|||.:|.|.||.|||||.:|:||:|||||:|:||:||||.|.||:||
Human     5 QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRG 69

  Fly    72 PFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRK 136
            |:|||||||||::.||||:|||||||||||.||:||||||.||||::|:|||.|::|:.|:..||
Human    70 PYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 134

  Fly   137 YCQVGRLSHEVGWHYQDVIKSLERKRKAKLRVTLKHNRELKKLTVKARENIAKAAEPFNKIIKSY 201
            :..:|||:|||||.||.|..:||.|||.|.::..:..::|.:|..:|.:|:.|..:.:.:::|::
Human   135 FAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKYTEVLKTH 199

  Fly   202 G 202
            |
Human   200 G 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13ANP_649560.1 Ribosomal_L13 6..203 CDD:412316 114/196 (58%)
RPL13ANP_036555.1 PTZ00068 6..200 CDD:240253 113/193 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143162
Domainoid 1 1.000 161 1.000 Domainoid score I4041
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H111053
Inparanoid 1 1.050 254 1.000 Inparanoid score I3202
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53755
OrthoDB 1 1.010 - - D1312756at2759
OrthoFinder 1 1.000 - - FOG0001720
OrthoInspector 1 1.000 - - oto88891
orthoMCL 1 0.900 - - OOG6_100793
Panther 1 1.100 - - LDO PTHR11545
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1111
SonicParanoid 1 1.000 - - X1276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.