DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13A and Rpl13a

DIOPT Version :9

Sequence 1:NP_649560.1 Gene:RpL13A / 40687 FlyBaseID:FBgn0037351 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_033464.2 Gene:Rpl13a / 22121 MGIID:1351455 Length:203 Species:Mus musculus


Alignment Length:196 Identity:113/196 - (57%)
Similarity:156/196 - (79%) Gaps:0/196 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLRKRCNVNPARG 71
            :.:|:|||||||||||::|||.:|.|.||.|||||.:|:||:|||||:|:||:||||.|.||:||
Mouse     5 QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRG 69

  Fly    72 PFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRK 136
            |:|||||||||::.||||:|||||||||||.||:|.||||.||||::|:|||.|::|:.|:..||
Mouse    70 PYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRK 134

  Fly   137 YCQVGRLSHEVGWHYQDVIKSLERKRKAKLRVTLKHNRELKKLTVKARENIAKAAEPFNKIIKSY 201
            :..:|||:|||||.||.|..:||.|||.|.::..:..:::.:|..:|.:|:.|....|.:::|:.
Mouse   135 FAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQILRLRKQAEKNVEKKICKFTEVLKTN 199

  Fly   202 G 202
            |
Mouse   200 G 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13ANP_649560.1 Ribosomal_L13 6..203 CDD:412316 113/196 (58%)
Rpl13aNP_033464.2 PTZ00068 6..191 CDD:240253 110/184 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833327
Domainoid 1 1.000 159 1.000 Domainoid score I4092
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H111053
Inparanoid 1 1.050 248 1.000 Inparanoid score I3243
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53755
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001720
OrthoInspector 1 1.000 - - oto92457
orthoMCL 1 0.900 - - OOG6_100793
Panther 1 1.100 - - LDO PTHR11545
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1111
SonicParanoid 1 1.000 - - X1276
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.