DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and HLJ1

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_013884.1 Gene:HLJ1 / 855196 SGDID:S000004771 Length:224 Species:Saccharomyces cerevisiae


Alignment Length:155 Identity:43/155 - (27%)
Similarity:59/155 - (38%) Gaps:41/155 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            :|||:|.|...|:..|||.:|::|.::.||||   ...|..| ||    |..||.|:..|.:..:
Yeast    21 EFYEILKVDRKATDSEIKKAYRKLAIKLHPDK---NSHPKAG-EA----FKVINRAFEVLSNEEK 77

  Fly    68 RKHYDAELLQSKFRAHSNIYATVVLSEMQRIQVEIEEDDDEAPAPSAPPPCQASESESESEANKG 132
            |..||                            .|..|.|:...||.........|...|....|
Yeast    78 RSIYD----------------------------RIGRDPDDRQMPSRGAASGFRGSAGGSPMGGG 114

  Fly   133 PATMWSYAYDCRCGGQYLFDGPADD 157
            ...|:   ::.|.|||..  ||.:|
Yeast   115 FEDMF---FNSRFGGQRA--GPPED 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 25/68 (37%)
zf-CSL <135..179 CDD:282991 8/23 (35%)
HLJ1NP_013884.1 DnaJ_bact 22..>154 CDD:274090 43/154 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.