DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and ARL2

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_176206.2 Gene:ARL2 / 842292 AraportID:AT1G59980 Length:414 Species:Arabidopsis thaliana


Alignment Length:112 Identity:32/112 - (28%)
Similarity:51/112 - (45%) Gaps:24/112 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIRRK 69
            ||:|.:||.::..|||.:|:::.|:.||||       ||........|..:..|:..|.||..|:
plant    25 YEVLGIPSNSTDQEIKSAYRRMALRYHPDK-------NPDDPVAAEMFKEVTFAYEVLSDPENRR 82

  Fly    70 HYDA-------------ELLQSKFRAHSNIYATVVLSEMQRIQVEIE 103
            .||.             ||..|...|.:.|:|.:    ..::.|:|:
plant    83 LYDTTGSEAVGPENEDLELDLSSLGAVNTIFAAL----FNKLGVQIK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 22/66 (33%)
zf-CSL <138..179 CDD:398744
ARL2NP_176206.2 PRK14295 11..>176 CDD:237665 32/112 (29%)
DnaJ 23..85 CDD:395170 22/66 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.