DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and AT1G59725

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_176181.1 Gene:AT1G59725 / 842265 AraportID:AT1G59725 Length:331 Species:Arabidopsis thaliana


Alignment Length:72 Identity:28/72 - (38%)
Similarity:45/72 - (62%) Gaps:9/72 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSD--FNAINAAWNTLKDP 65
            |:|.:|||..:|:.|::|.||::|.::.||||       ||.|..|.::  |..|:.|::.|.||
plant     4 DYYNVLNVNPSATEDDLKKSYRRLAMKWHPDK-------NPTSIKQEAEAKFKQISEAYDVLSDP 61

  Fly    66 IRRKHYD 72
            .:|:.||
plant    62 NKRQIYD 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 26/70 (37%)
zf-CSL <138..179 CDD:398744
AT1G59725NP_176181.1 DnaJ_bact 4..325 CDD:274090 28/72 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.