DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and ARL1

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_173822.2 Gene:ARL1 / 839024 AraportID:AT1G24120 Length:436 Species:Arabidopsis thaliana


Alignment Length:190 Identity:45/190 - (23%)
Similarity:73/190 - (38%) Gaps:71/190 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            |.||:|.|...::..|||.:|::|.|:.||||  ..:||     .....|..:..::|.|.||.:
plant    20 DPYEVLGVLRNSTDQEIKSAYRKLALKYHPDK--TANDP-----VAADMFKEVTFSYNILSDPEK 77

  Fly    68 RKHYDA-------------ELLQSKFRAHSNIYATV---------------VLSEM--------- 95
            |:.:|:             ||..|...|.:.::|.:               :|.|.         
plant    78 RRQFDSAGFEAVEAESQELELDLSSLGAVNTVFAALFSKLGVPIKTSVSATILEEALNGRVSVDP 142

  Fly    96 ----QRIQVEIEE----------DDDEAPAPSAPPPCQASESESES---------EANKG 132
                |.:..::|:          .::|.   ||...|:. ||.|:|         |||.|
plant   143 LVLGQAVSKKVEKQCAHFYAVTISEEEV---SAGLVCRV-ESSSKSKFKLLYFDQEANSG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 23/68 (34%)
zf-CSL <138..179 CDD:398744
ARL1NP_173822.2 PRK14284 20..>174 CDD:237658 36/163 (22%)
DnaJ 20..82 CDD:395170 23/68 (34%)
ClpA <293..>361 CDD:440308
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.