DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and AT1G10350

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_172506.1 Gene:AT1G10350 / 837574 AraportID:AT1G10350 Length:349 Species:Arabidopsis thaliana


Alignment Length:127 Identity:36/127 - (28%)
Similarity:57/127 - (44%) Gaps:31/127 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQ-NSDFNAINAAWNTLKDPI 66
            |:|.:|.|...|:.|::|.||:::.::.||||       ||.|:.: .:.|..|:.|::.|.||.
plant     4 DYYNVLKVNRNANEDDLKKSYRRMAMKWHPDK-------NPTSKKEAEAKFKQISEAYDVLSDPQ 61

  Fly    67 RRKHYDAELLQSKFRAHSNIYATVVLSEMQRIQVEIEEDDDEAPAPSAPPPCQASESESESE 128
            ||:.||                       |..:..::..|....|.:|....|.|.|.|.||
plant    62 RRQIYD-----------------------QYGEEGLKSTDLPTAAETAAHQQQRSYSSSNSE 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 24/69 (35%)
zf-CSL <138..179 CDD:398744
AT1G10350NP_172506.1 DnaJ_bact 4..343 CDD:274090 36/127 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.