DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and AT1G09260

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_172397.1 Gene:AT1G09260 / 837447 AraportID:AT1G09260 Length:138 Species:Arabidopsis thaliana


Alignment Length:78 Identity:21/78 - (26%)
Similarity:40/78 - (51%) Gaps:12/78 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YELLNVPST-ASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIRR 68
            |::|.:.:. .|...|:..|:.::::.:||..:.:        |..|.|..||.||..|.||.:|
plant    72 YDILRISNPFCSHQMIQRKYRDILVKLYPDTNKSI--------AAKSAFEIINYAWKILSDPEKR 128

  Fly    69 KHYDAELLQSKFR 81
            |.|:   ::.:|:
plant   129 KDYN---IKKRFK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 19/67 (28%)
zf-CSL <135..179 CDD:282991
AT1G09260NP_172397.1 DnaJ 70..132 CDD:365959 19/67 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1580122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.