DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and AT5G62780

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_201084.1 Gene:AT5G62780 / 836399 AraportID:AT5G62780 Length:207 Species:Arabidopsis thaliana


Alignment Length:144 Identity:39/144 - (27%)
Similarity:64/144 - (44%) Gaps:19/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLR--QLDDPNPGSEAQNSD--FNAINAAWNTL- 62
            |:|.:|.|...|..:.:|..||.|.|..||||.|  ..::|...|.::..|  |:.::..::|: 
plant    18 DWYGILGVDPLADDETVKKHYKTLALLLHPDKNRFNGAEEPASSSSSKPVDMTFSTVSMTFSTVC 82

  Fly    63 -KDPIRRKHYDAE-LLQSKF--------RAHSNIYATVVLSEMQRIQVEIEEDDDEAPAPS-APP 116
             |...|..|:..: .|...|        .|.:||.:|.|::....|:|.:....:|   || |..
plant    83 NKCTTRCCHFSTQNHLNKTFPCPNCGQNSAMTNISSTEVINGRTFIRVSVSPQQEE---PSRANS 144

  Fly   117 PCQASESESESEAN 130
            ...:..|....:||
plant   145 QATSRRSTRHDDAN 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 23/74 (31%)
zf-CSL <138..179 CDD:398744
AT5G62780NP_201084.1 DnaJ 18..>57 CDD:395170 15/38 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.