DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and AT5G53150

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001331440.1 Gene:AT5G53150 / 835396 AraportID:AT5G53150 Length:755 Species:Arabidopsis thaliana


Alignment Length:172 Identity:46/172 - (26%)
Similarity:68/172 - (39%) Gaps:47/172 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            |:|.:|.|...||.:.:|..|::|:|..||||       |....|:.: ||.:..||..|.|..:
plant    66 DWYGVLGVDPFASDEALKKQYRKLVLMLHPDK-------NKCKGAEGA-FNLVAEAWALLSDKDK 122

  Fly    68 RKHY------DAELLQSKF-------RAHS-------NIYATVVLSEMQRIQVEIEEDDDEAPAP 112
            |..|      |.:..|.:|       .:|.       |:...||.|...|.:          || 
plant   123 RILYNVKRGKDVKAAQQRFPTTQREIPSHQPTSNGIPNVREHVVSSARARYK----------PA- 176

  Fly   113 SAPPPCQASESESESEANKGP----ATMWSYAYDC-RCGGQY 149
            :..|..:...|.:.|.|...|    :|.|:.   | :|..||
plant   177 TRKPAARMDRSRTGSPAFVYPTQESSTFWTM---CNKCDTQY 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 24/74 (32%)
zf-CSL <138..179 CDD:398744 4/13 (31%)
AT5G53150NP_001331440.1 DnaJ 66..127 CDD:395170 23/68 (34%)
zinc_YnfU_fam <208..239 CDD:439677 4/8 (50%)
DUF3444 473..682 CDD:463398
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.