DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and AT5G37760

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_198592.1 Gene:AT5G37760 / 833754 AraportID:AT5G37760 Length:207 Species:Arabidopsis thaliana


Alignment Length:96 Identity:25/96 - (26%)
Similarity:36/96 - (37%) Gaps:30/96 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIRRKHYDAELLQSKFR 81
            |::|..||:|.|..||||...     .|:|..   |..:..||..|.|.::|..||         
plant   117 DQLKKQYKKLALLLHPDKYNL-----NGAEGA---FKPVTEAWCMLSDKVKRTSYD--------- 164

  Fly    82 AHSNIYATVVLSEMQRIQVEIEEDDDEAPAP 112
                         .:||..|.:.:..:.|.|
plant   165 -------------QRRISKEAKTEIQKQPNP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 18/54 (33%)
zf-CSL <138..179 CDD:398744
AT5G37760NP_198592.1 DnaJ 109..164 CDD:395170 18/54 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.