DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and AT4G19580

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_193693.5 Gene:AT4G19580 / 827700 AraportID:AT4G19580 Length:312 Species:Arabidopsis thaliana


Alignment Length:177 Identity:38/177 - (21%)
Similarity:62/177 - (35%) Gaps:43/177 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKD-PI 66
            |:|.:|.:...|..:.:|..||:|.|..||||.|     ..|:|..   |..:..|.:.|.| |.
plant    66 DWYGILGIDPLADEEAVKKQYKKLALLLHPDKNR-----FNGAEGA---FKLVRHARDLLSDQPC 122

  Fly    67 RRKHYDAELLQSKFRAHSNIYATVVLSEMQRIQVEIEEDDDEAPAPSAPP--------------- 116
            ...:...:....|.:.|:.. .|.|..:.:|...:::........|..|.               
plant   123 LIYNVQGQTQTQKSQNHTRT-RTCVAYDHKRKPKQVKRKRSRTQDPPKPHKYKYKYEFRKRNRMH 186

  Fly   117 -------PCQASESESESEAN-----KGP------ATMWSYAYDCRC 145
                   .|.:..|||:.|.:     |.|      .|.|:...:.:|
plant   187 KPHEYAYECNSDSSESDPEPDSSWKQKKPRKQEEDITFWTVCKNNKC 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 21/69 (30%)
zf-CSL <135..179 CDD:282991 3/11 (27%)
AT4G19580NP_193693.5 DnaJ 66..119 CDD:278647 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1580122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.