DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and ATERDJ3B

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_191819.1 Gene:ATERDJ3B / 825434 AraportID:AT3G62600 Length:346 Species:Arabidopsis thaliana


Alignment Length:69 Identity:26/69 - (37%)
Similarity:40/69 - (57%) Gaps:7/69 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIRR 68
            :|::|.||..||.::||.:|::|.|:.||||       |.|:|.....|..||.|:..|.|..:|
plant    27 YYDVLQVPKGASDEQIKRAYRKLALKYHPDK-------NQGNEEATRKFAEINNAYEVLSDEEKR 84

  Fly    69 KHYD 72
            :.|:
plant    85 EIYN 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 25/67 (37%)
zf-CSL <138..179 CDD:398744
ATERDJ3BNP_191819.1 DnaJ_bact 26..343 CDD:274090 26/69 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.