DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and AT3G47940

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_190377.1 Gene:AT3G47940 / 823949 AraportID:AT3G47940 Length:350 Species:Arabidopsis thaliana


Alignment Length:70 Identity:24/70 - (34%)
Similarity:41/70 - (58%) Gaps:5/70 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            |:|.:|.|...|:.|::|.:||:|.:..||||     :|:...:...:.|..|:.|::.|.||.:
plant     4 DYYNILKVNHNATEDDLKKAYKRLAMIWHPDK-----NPSTRRDEAEAKFKRISEAYDVLSDPQK 63

  Fly    68 RKHYD 72
            |:.||
plant    64 RQIYD 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 22/68 (32%)
zf-CSL <138..179 CDD:398744
AT3G47940NP_190377.1 DnaJ_bact 4..339 CDD:274090 24/70 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.