DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and AT3G13310

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_187939.1 Gene:AT3G13310 / 820531 AraportID:AT3G13310 Length:157 Species:Arabidopsis thaliana


Alignment Length:92 Identity:35/92 - (38%)
Similarity:44/92 - (47%) Gaps:17/92 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIRRK 69
            ||||.|..|||..|||.:|:.|....|||          .||:...||..|:.|:.||.||..|.
plant    66 YELLKVNETASLTEIKTAYRSLAKVYHPD----------ASESDGRDFMEIHKAYATLADPTTRA 120

  Fly    70 HYDAELLQSKFRAHS-------NIYAT 89
            .||:.|...:.|.|:       .:|||
plant   121 IYDSTLRVPRRRVHAGAMGRSGRVYAT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 27/66 (41%)
zf-CSL <138..179 CDD:398744
AT3G13310NP_187939.1 DnaJ 64..123 CDD:395170 27/66 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.