DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and AT2G17880

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_179378.1 Gene:AT2G17880 / 816298 AraportID:AT2G17880 Length:160 Species:Arabidopsis thaliana


Alignment Length:76 Identity:30/76 - (39%)
Similarity:43/76 - (56%) Gaps:6/76 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIRRK 69
            ||:|.:|..::..|||.:|::|...||||..|     |....:...||..|:||:.||.||.:|.
plant    70 YEILEIPVGSTSQEIKSAYRRLARICHPDVAR-----NSRDNSSADDFMKIHAAYCTLSDPEKRA 129

  Fly    70 HYDAE-LLQSK 79
            .||.. ||:|:
plant   130 VYDRRTLLRSR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 25/66 (38%)
zf-CSL <138..179 CDD:398744
AT2G17880NP_179378.1 DnaJ 68..132 CDD:395170 25/66 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.