DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and dnajc24

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001037943.2 Gene:dnajc24 / 733569 XenbaseID:XB-GENE-1016343 Length:145 Species:Xenopus tropicalis


Alignment Length:173 Identity:44/173 - (25%)
Similarity:72/173 - (41%) Gaps:41/173 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSD-FNAINAAWNTLKDPI 66
            |:|.:|....:.:..|:|..|::|.|..||||  |..|...|...:.:. |..||.||..|.:..
 Frog    10 DWYSILGAKPSDTQAEVKQKYQKLALLYHPDK--QSADMMAGQAGEGAQRFIEINQAWKILGNEE 72

  Fly    67 RRKHYDAELLQSKFRAHSNIYATVVLSEMQRIQVEIEEDDDEAPAPSAPPPCQASESESESEANK 131
            .:|.||.:..:::            |::|..:..::..:|                      .:.
 Frog    73 AKKAYDLQQREAE------------LTKMWPVDNQVHWED----------------------LSW 103

  Fly   132 GPATMWSYAYDCRCGGQYLFDGPADDDESPEVIVECNECSLVI 174
            .|.|| .|::.|||||.|..   .:.|.....:|.|:.|||:|
 Frog   104 DPETM-VYSFPCRCGGSYAM---TESDRKDVSLVNCDSCSLII 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 22/69 (32%)
zf-CSL <135..179 CDD:282991 16/40 (40%)
dnajc24NP_001037943.2 DnaJ 10..78 CDD:365959 22/69 (32%)
zf-CSL 95..145 CDD:368338 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1580122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.