powered by:
Protein Alignment CG2911 and Dnajb3
DIOPT Version :9
Sequence 1: | NP_001097689.1 |
Gene: | CG2911 / 40686 |
FlyBaseID: | FBgn0037350 |
Length: | 183 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102866.1 |
Gene: | Dnajb3 / 680216 |
RGDID: | 1594215 |
Length: | 241 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 27/72 - (37%) |
Similarity: | 41/72 - (56%) |
Gaps: | 6/72 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MPDFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDP 65
|.|:||:|.||..||.:.|:.:|::|.|:.|||| :|....||:.. |..:..|:..|.|.
Rat 1 MVDYYEVLGVPRQASAEAIRKAYRKLALKWHPDK-----NPEHKEEAERR-FKQVAQAYEVLSDA 59
Fly 66 IRRKHYD 72
.:|:.||
Rat 60 RKREVYD 66
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2911 | NP_001097689.1 |
DnaJ |
3..72 |
CDD:278647 |
24/68 (35%) |
zf-CSL |
<135..179 |
CDD:282991 |
|
Dnajb3 | NP_001102866.1 |
DnaJ |
3..66 |
CDD:395170 |
24/68 (35%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.