DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and Dnajc10

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_077143.2 Gene:Dnajc10 / 66861 MGIID:1914111 Length:793 Species:Mus musculus


Alignment Length:163 Identity:48/163 - (29%)
Similarity:60/163 - (36%) Gaps:66/163 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            :||.||.|..|||..||:.::|:|.|:.||||       ||.:...:.||..||.|:..|||...
Mouse    35 NFYSLLGVSKTASSREIRQAFKKLALKLHPDK-------NPNNPNAHGDFLKINRAYEVLKDEDL 92

  Fly    68 RKHYDAELLQSKFRAHSNIYATVVLSEMQRIQVEIEEDDDEAPAPSAPPPCQASESESESEANKG 132
            ||.||.             |....|.:.|..|.|                               
Mouse    93 RKKYDK-------------YGEKGLEDNQGGQYE------------------------------- 113

  Fly   133 PATMWSYAYDCRCGGQYLFD-GPADDDESPEVI 164
               .|||         |.:| |..|||  ||:|
Mouse   114 ---SWSY---------YRYDFGIYDDD--PEII 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 29/68 (43%)
zf-CSL <135..179 CDD:282991 12/31 (39%)
Dnajc10NP_077143.2 DnaJ 34..>132 CDD:223560 47/161 (29%)
DnaJ 35..97 CDD:278647 29/68 (43%)
PDI_a_ERdj5_N 129..229 CDD:239301 3/4 (75%)
ER_PDI_fam 130..551 CDD:273457 2/3 (67%)
Trxb 1 235..350
Trxb 2 348..463
PDI_a_ERdj5_C 453..550 CDD:239302
PDI_a_ERdj5_C 556..663 CDD:239302
PDI_a_ERdj5_C 670..775 CDD:239302
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 790..793
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0713
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.