DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2911 and Samd13

DIOPT Version :9

Sequence 1:NP_001097689.1 Gene:CG2911 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_064474.1 Gene:Samd13 / 56764 RGDID:708544 Length:223 Species:Rattus norvegicus


Alignment Length:163 Identity:45/163 - (27%)
Similarity:64/163 - (39%) Gaps:52/163 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPDFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGS-EAQNSDFNAINAAWNTLKD 64
            |.::|::|.||..||..:||.::.||.||.||||       |||. ||....|..:..|:..|.|
  Rat     1 MVNYYKVLGVPQDASSSDIKKAFHQLALQVHPDK-------NPGDREAAEEKFKQVAEAYQILSD 58

  Fly    65 PIRRKHYD--------AELLQSKFRAHSNIYATVVLSEMQRIQVEIEEDDDEAPAPSAPPPCQAS 121
            ..:||.||        .||::...|..:|....:.....:|....:.||:|              
  Rat    59 AKKRKDYDRSRWSRTKEELIRGDGRDETNWEEEICSRRPRRTFQTVIEDED-------------- 109

  Fly   122 ESESESEANKGPATMWSYAYDCRCGGQYLFDGP 154
                          ::|        |.|||.||
  Rat   110 --------------LFS--------GDYLFTGP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2911NP_001097689.1 DnaJ 3..72 CDD:278647 27/69 (39%)
zf-CSL <135..179 CDD:282991 7/20 (35%)
Samd13NP_064474.1 DnaJ 2..>67 CDD:223560 28/71 (39%)
DnaJ 3..66 CDD:278647 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.