DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2911 and dnajc10

DIOPT Version :9

Sequence 1:	NP_001097689.1	Gene:	CG2911 / 40686	FlyBaseID:	FBgn0037350	Length:	183	Species:	Drosophila melanogaster
Sequence 2:	NP_001077016.1	Gene:	dnajc10 / 557858	ZFINID:	ZDB-GENE-070327-1	Length:	791	Species:	Danio rerio

Alignment Length:	162	Identity:	41/162 - (25%)
Similarity:	56/162 - (34%)	Gaps:	65/162 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67
            |:|:||.:...||..:|:.::|:|.|..||||       ||..|..:..|..||.|:..|||...
Zfish    33 DYYKLLGISREASTRDIRQAFKKLALTMHPDK-------NPNDETAHDKFLKINRAYEVLKDEDL 90

  Fly    68 RKHYDAELLQSKFRAHSNIYATVVLSEMQRIQVEIEEDDDEAPAPSAPPPCQASESESESEANKG 132
            ||.||                                              :..|...:.|...|
Zfish    91 RKKYD----------------------------------------------KYGEKGLQDEQQGG 109

  Fly   133 PATMWSYAYDCRCGGQYLFD-GPADDDESPEV 163
            ....|:|         |.:| |..|||  ||:
Zfish   110 RYESWNY---------YRYDFGIYDDD--PEI 130

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2911	NP_001097689.1	DnaJ	3..72	CDD:278647	26/68 (38%)
CG2911	NP_001097689.1	zf-CSL	<135..179	CDD:282991	10/30 (33%)
dnajc10	NP_001077016.1	DnaJ	33..>129	CDD:223560	39/159 (25%)
		DnaJ	33..95	CDD:278647	26/68 (38%)
		PDI_a_ERdj5_N	128..228	CDD:239301	2/3 (67%)
		ER_PDI_fam	129..648	CDD:273457	1/2 (50%)
		Thioredoxin_like	<276..318	CDD:294274
		PDI_a_family	348..443	CDD:239259
		PDI_a_ERdj5_C	450..546	CDD:239302
		PDI_a_ERdj5_C	552..660	CDD:239302
		PDI_a_ERdj5_C	666..772	CDD:239302
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0713
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.810