DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dph4 and dph3

DIOPT Version :10

Sequence 1:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001153296.1 Gene:dph3 / 553692 ZFINID:ZDB-GENE-050522-545 Length:85 Species:Danio rerio


Alignment Length:87 Identity:21/87 - (24%)
Similarity:35/87 - (40%) Gaps:30/87 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QVEIEEDDDEAPAPSAPPPCQASESESESEANKGPATMWSYAYDCRCGGQYLFDGPADDDESPEV 163
            :||||:                .|.:.|:|         :|.:.|.||.::..  ..:|.|:.|.
Zfish     7 EVEIED----------------FEYDEETE---------TYYFPCPCGDRFAI--TKEDLENGEE 44

  Fly   164 IVECNECSLVIIV---KQAASC 182
            :..|..|||::.|   |:...|
Zfish    45 VATCPSCSLIVKVIYDKEQFMC 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dph4NP_649559.1 DnaJ 3..72 CDD:395170
zf-CSL <138..179 CDD:398744 13/43 (30%)
dph3NP_001153296.1 zf-CSL 4..65 CDD:419794 20/84 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.